PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000791870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 375aa    MW: 39915.2 Da    PI: 7.1945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000791870genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-184693148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEdell++++k+ G g+W+t ++  g+ R++k+c++rw +yl
    MDP0000791870 46 RGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYL 93
                     89******************************99************97 PP

2Myb_DNA-binding46.77.5e-15104144648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000791870 104 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 144
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-223795IPR009057Homeodomain-like
PROSITE profilePS5129416.7694193IPR017930Myb domain
SuperFamilySSF466893.67E-2943140IPR009057Homeodomain-like
SMARTSM007171.6E-134595IPR001005SANT/Myb domain
PfamPF002498.3E-164693IPR001005SANT/Myb domain
CDDcd001672.45E-114893No hitNo description
PROSITE profilePS5129424.39794148IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2496149IPR009057Homeodomain-like
SMARTSM007172.7E-1398146IPR001005SANT/Myb domain
CDDcd001671.55E-11104144No hitNo description
PfamPF002491.2E-13104144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MRNPSSSSKA TAAASATMTT ASPSSSKAGI AGGSKTPCCV KVGLKRGPWT PEEDELLANY  60
IKKEGEGRWR TLPKQAGLLR CGKSCRLRWM NYLRPSVKRG QIAPDEEDLI LRLHRLLGNR  120
WSLIAGRIPG RTDNEIKNYW NTHLSKKLIS QGIDPRTHKP LNPDHHSAAA DADVGNTNKS  180
AAAAASSKAN NRFSNPNPSP PPSDRLVHQG ADPSINGNDG NIAIDDHDLG TIVHSCANMT  240
TSINNPDASS SAAAMGTLSL RTNNNSHAGV LLGGGGNEED EDINCCADDV FSSFLNSLIN  300
EDPFSVQHQL QQQVLHNGNV STHAAGAGSD HVPLISMTSA STMAPSTFGW DSAVLMSSAF  360
NQNDHQRVTD QTEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26441485108B-MYB
1mse_C3e-26441482105C-Myb DNA-Binding Domain
1msf_C3e-26441482105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158060.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201110.0KJ020111.1 Malus hybrid cultivar MYB12b protein (MYB12b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351527.10.0PREDICTED: transcription repressor MYB5
TrEMBLX2EZI40.0X2EZI4_9R
STRINGVIT_06s0004g00570.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-80myb domain protein 5